PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030813
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB_related
Protein Properties Length: 291aa    MW: 31217 Da    PI: 10.931
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030813genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-13105149347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
      Lus10030813 105 PWTEEEHRMFLVGLEKVGKGDWRGISRNFVKTRTPTQVASHAQKY 149
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.25398154IPR017930Myb domain
SuperFamilySSF466891.94E-17100154IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-17101152IPR006447Myb domain, plants
SMARTSM007173.0E-10102152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-11104149IPR009057Homeodomain-like
CDDcd001672.04E-9105150No hitNo description
PfamPF002491.1E-10105149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MSRICSQCGI NGHNSRTCGG ELSCITSGDA TGAAENGIML FGVRLTAGMN NTFRKSASMN  60
NLSMYADHRN HSSVSDGVVV VASGYESDDV IHASGRGRER KRGVPWTEEE HRMFLVGLEK  120
VGKGDWRGIS RNFVKTRTPT QVASHAQKYF LRRNNQNRRR RRSSLFDITT DNTPSPNQEA  180
AAAALFKANS VHLSKFPVPT FPSATITGER LMLGSPTARP NVGRPIPIPP SSKMASLNLN  240
QKQEPFLPLS LRLSSTPSPG EQSSSSSAGT RSSSSAFQGM SSGDSIISVA *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438523.17e-95hypothetical protein CICLE_v10032167mg
TrEMBLV4SV577e-95V4SV57_9R
TrEMBLA0A067H5749e-95A0A067H574_CITSI; Uncharacterized protein
STRINGGLYMA01G04530.12e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.23e-68MYB_related family protein